pYES3/CT
Catalog No. PVT11237
Packing 2ug
pYES3/CT Information
Function yeast expression plasmid
Promoter: T7, GAL1, TRP1
Replicator: 2 ori, ori, FI ori
Terminator: CYC1
Plasmid classification: yeast series, Saccharomyces cerevisiae expression vector
Plasmid size: 5870bp
Prokaryotic resistance: Amp
Screening markers: TRP1
Cloned strain: DH5 alpha
Culture conditions: 37 centigrade, aerobic LB
Expression host: yeast cells
Induction method: galactose induction
5'sequencing primers: GAL1-F: ATTTTCGGTTTGTATTACTTC
3'sequencing primers: GALI-R: GTTCTTAATACTAACATAACT
pYES3/CT Description
pYES3/CT and pYES6/CT are S. cerevisiae expression vectors derived from the parental pYES2 vector. Vectors feature a C-terminal V5 epitope for detection with an Anti-V5 Antibody. pYES3/CT carries the TRP1 selection marker for selection in yeast. pYES6/CT carries the bsd resistance gene for selection with the antibiotic Blasticidin, a potent selection agent that can be used at very low concentrations and in any strain regardless of auxotrophic marker.

pYES3/CT Sequence
LOCUS Exported 5870 bp ds-DNA circular SYN 29-NOV-2013
DEFINITION High-copy episomal vector with a TRP1 marker for galactose-inducible
expression of C-terminally tagged proteins in S. cerevisiae.
ACCESSION .
VERSION .
KEYWORDS pYES3 CT
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5870)
AUTHORS Invitrogen (Life Technologies)
TITLE Direct Submission
JOURNAL Exported Sunday, September 11, 2016 from SnapGene Viewer 3.1.4
FEATURES Location/Qualifiers
source 1..5870
/organism="synthetic DNA construct"
/lab_host="Saccharomyces cerevisiae"
/mol_type="other DNA"
promoter 2..443
/gene="S. cerevisiae GAL1"
/note="GAL1 promoter"
/note="inducible promoter, regulated by Gal4"
protein_bind 2..119
/bound_moiety="Gal4"
/note="UAS"
/note="upstream activating sequence mediating
Gal4-dependent induction"
promoter 475..493
/note="T7 promoter"
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature 501..600
/note="MCS"
/note="multiple cloning site"
CDS 607..648
/codon_start=1
/product="epitope tag from simian virus 5"
/note="V5 tag"
/translation="GKPIPNPLLGLDST"
CDS 658..675
/codon_start=1
/product="6xHis affinity tag"
/note="6xHis"
/translation="HHHHHH"
terminator 709..956
/gene="S. cerevisiae CYC1"
/note="CYC1 terminator"
/note="transcription terminator for CYC1"
rep_origin complement(1204..1792)
/direction=LEFT
/note="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(1963..2823)
/codon_start=1
/gene="bla"
/product="beta-lactamase"
/note="AmpR"
/note="confers resistance to ampicillin, carbenicillin, and
related antibiotics"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKRSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
promoter complement(2824..2928)
/gene="bla"
/note="AmpR promoter"
promoter 3031..3132
/gene="S. cerevisiae TRP1"
/note="TRP1 promoter"
CDS 3133..3807
/codon_start=1
/gene="S. cerevisiae TRP1"
/product="phosphoribosylanthranilate isomerase, required
for tryptophan biosynthesis"
/note="TRP1"
/note="yeast auxotrophic marker"
/translation="MSVINFTGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK
RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES
WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW
VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA
KK"
rep_origin 4449..5329
/note="2u ori"
/note="yeast 2u plasmid origin of replication"
rep_origin complement(5398..5853)
/direction=LEFT
/note="f1 ori"
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
ORIGIN
1 acggattaga agccgccgag cgggtgacag ccctccgaag gaagactctc ctccgtgcgt
61 cctcgtcttc accggtcgcg ttcctgaaac gcagatgtgc ctcgcgccgc actgctccga
121 acaataaaga ttctacaata ctagctttta tggttatgaa gaggaaaaat tggcagtaac
181 ctggccccac aaaccttcaa atgaacgaat caaattaaca accataggat gataatgcga
241 ttagtttttt agccttattt ctggggtaat taatcagcga agcgatgatt tttgatctat
301 taacagatat ataaatgcaa aaactgcata accactttaa ctaatacttt caacattttc
361 ggtttgtatt acttcttatt caaatgtaat aaaagtatca acaaaaaatt gttaatatac
421 ctctatactt taacgtcaag gagaaaaaac cccggatcgg actactagca gctgtaatac
481 gactcactat agggaatatt aagcttggta ccgagctcgg atccactagt aacggccgcc
541 agtgtgctgg aattctgcag atatccagca cagtggcggc cgctcgagtc tagagggccc
601 ttcgaaggta agcctatccc taaccctctc ctcggtctcg attctacgcg taccggtcat
661 catcaccatc accattgagt ttaaacccgc tgatcctaga gggccgcatc atgtaattag
721 ttatgtcacg cttacattca cgccctcccc ccacatccgc tctaaccgaa aaggaaggag
781 ttagacaacc tgaagtctag gtccctattt atttttttat agttatgtta gtattaagaa
841 cgttatttat atttcaaatt tttctttttt ttctgtacag acgcgtgtac gcatgtaaca
901 ttatactgaa aaccttgctt gagaaggttt tgggacgctc gaaggcttta atttgcaagc
961 tgcggccctg cattaatgaa tcggccaacg cgcggggaga ggcggtttgc gtattgggcg
1021 ctcttccgct tcctcgctca ctgactcgct gcgctcggtc gttcggctgc ggcgagcggt
1081 atcagctcac tcaaaggcgg taatacggtt atccacagaa tcaggggata acgcaggaaa
1141 gaacatgtga gcaaaaggcc agcaaaagcc caggaaccgt aaaaaggccg cgttgctggc
1201 gtttttccat aggctccgcc cccctgacga gcatcacaaa aatcgacgct caagtcagag
1261 gtggcgaaac ccgacaggac tataaagata ccaggcgttt ccccctggaa gctccctcgt
1321 gcgctctcct gttccgaccc tgccgcttac cggatacctg tccgcctttc tcccttcggg
1381 aagcgtggcg ctttctcata gctcacgctg taggtatctc agttcggtgt aggtcgttcg
1441 ctccaagctg ggctgtgtgc acgaaccccc cgttcagccc gaccgctgcg ccttatccgg
1501 taactatcgt cttgagtcca acccggtaag acacgactta tcgccactgg cagcagc