SDF-1 β（基质细胞衍生因子-1）

Product description:
Human SDF-1β produced in E. coli is non-glycosylated polypeptide chain containing 74 amino acids (3-74 a.a.; predicted MW=8.7kDa.). The recombinant protein was purified by cation exchange chromatography and gel filtration chromatography. Purity is greater than 98% by SDS-PAGE and Coomassie blue staining (Figure A). The protein was active in ELISA assay with an EC50 of about 80nM (Figure B) and the measured MW in LC-MS was 8802 Dalton, in agreement with its theoretic molecular weight (Figure C).

GenBank accession number:

Amino acid sequence:
MGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Activity:
ELISA to measure SDF-1β binding activity (Figure B). SDF-1 was immobilized on the plate and was detected by anti SDF-1 antibody (Santacruz sc-6193 ).

Formulation:
Lyophilized from a 0.22μm filtered solution at a concentration of 1mg/mlin PBS.

Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 1.0 mg/ml.

Shipping&Stablity:
The Product is shipped at ambient temperature. Upon reconstitution, the preparation is stable for up to 1 month at 2-8°C. For long term storage, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles

Figure A. The purity of recombinant protein SDF-1β (AZ-002). 15 % SDS-PAGE, 1.2μg protein without (lane 1) and with (lane 2) DTT.
Figure B. ELISA to measure the activity of SDF-1 β (AZ-002)

Figure C. The molecular weight of SDF-1 β was 8802 Dalton in LC-MS spectrum analysis, consistent with its calculated MW.

For ordering and further information on this or other AbZyme products, contact customer Services

Product	Species	Catalog#	Amount
SDF-1β	human	AZ-002-10	10μg
SDF-1β	human	AZ-002-50	50μg
SDF-1β	human	AZ-002-1mg	1mg

Products for Research Only.

Background:
SDF-1 (stromal cell-derived factor-1), also called CXCL12, is small cytokine belonging to the chemokine family. The two forms, SDF-1 α/CXCL12a and SDF-1 β/CXCL12b, are produced in cells by alternate splicing of the same gene. SDF-1 signal throμgh its receptor CXCR4, and have been shown to chemoattract B and T cells, induce migration of CD34+ stem cells. Additionally, SDF-1 and its receptor CXCR4 are involved in human disease states (e.g. HIV/AIDS) and cancer metastasis.