Anti-MERSC-CoV Spike Protein

Form Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. Concentration 3.00 mg/ml Isotype IgG Clonality Polyclonal Conjugation Unconjugated Immunogen Purified recombinant peptide derived from within residues 381-505 aa (Spike receptor binding domain) of Spike protein from Middle East respiratory syndrome coronavirus produced in E. coli. Antigen Sequence VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSR Specificity Detects MERSC-CoV Spike (receptor binding domain) recombinant fusion proteins (MBP-S-protein and GFP-S-protein). Storage For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours. Special instructions The antibody solution should be gently mixed before use