Description Human Des(1-3)Insulin-like Growth Factor-I (IGF-I) is a 67 amino acid analog of human IGF-I lacking the N-terminal tripeptide Gly-Pro-Glu. Human Des(1-3)IGF-I is more potent than IGF-I in vitro and in vivo. This increased potency is due to reduced binding of human Des(1-3)IGF-I to most of the IGF binding proteins which normally inhibit the biological actions of IGF-I. Human Des(1-3)IGF-I binds to the Type 1 IGF receptor with similar affinity to full length IGF-I.
AA Sequence TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK PAKSA
Source Escherichia coli.
Molecular Weight 7.4 kDa, a single non-glycosylated polypeptide chain containing 67 amino acid residues.
Biological Activity The ED50 was determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of >5×10^5 IU/mg.
Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Endotoxin Less than 1 EU/μg of rHuDES1-3/IGF1 as determined by LAL method.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentratio
Storage This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at
Usage This product is for research use only. It is not approved for use in humans, animals, or in vitro diagnostic procedures.