Recombinant Human Insulin Like

GH-dependant binding protein, IBP3, BP-53, IGFBP-3.

IGFBP3 is a member of the IGFBP family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with IGFALS and either IGF I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

IGFBP3 Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 264 amino acids and having a molecular mass of 28806 Dalton.
IGFBP-3 is purified by proprietary chromatographic techniques.

Escherichia Coli.

Sterile Filtered White lyophilized (freeze-dried) powder.

Lyophilized from a 0.2µm filtered concentrated (0.5mg/ml) solution in PBS, pH 7.4.

It is recommended to reconstitute the lyophilized IGFBP3 in sterile 20mM AcOH (acetic Acid) not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Lyophilized IBP3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C.
Upon reconstitution IGF-BP 3 should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

GASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCGSGL

RCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSST

HRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLN

HLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK

The ED_50, calculated by by its ability to inhibit IGF-II induced proliferation of MCF-7 is < 200ng/ml in the presence of 15ng/ml of Human IGF-II, corresponding to a specific activity of 5.0 × 10³ IU/mg.

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

SDS