Rab11b Polyclonal Antibody

Form Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. Concentration 3.00 mg/ml Isotype IgG Clonality Polyclonal Conjugation Unconjugated Immunogen Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab11b produced in E. coli. Antigen Sequence MVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISVPPTTDGQRPNKLQCCQSL Specificity Detects a band of 25 kDa by Western blot in the following human, rat and mouse whole cell lysates and transfected cells with GFP-Rab11b cds. This Ab is specific for Rab11b, it does not recognize Rab11a. Storage For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours. Special instructions The antibody solution should be gently mixed before use.