Anti-tdTomato, DyLight®488

Form Polyclonal antibody supplied as a 100 µl (2.5 mg/ml) aliquot in PBS, 20% glycerol, 0.05% ProClin® and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. Concentration 2.50 mg/ml Isotype IgG Clonality Polyclonal Conjugation DyLight®488 Immunogen Purified recombinant peptide produced in E. coli. Antigen Sequence MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSNGGMDEVYK Specificity In 293HEK cells transfected with cds plasmid detects a band of 55 kDa by Western blot. It also detects tdTomato in brain sections by IHC. This antibody is specific for tdTomato and mCherry proteins. It does not cross-react to GFP (green fluorescent protein). Storage Store at -20 C for long-term storage. Store at 2-8 C for up to one month. Special instructions Avoid freeze/thaw cycles.