anti-Envelope Protein (SARS-Co

Form ​Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. Concentration 3.00 mg/ml Isotype IgG Clonality Polyclonal Conjugation Unconjugated Immunogen Affinity purified recombinant fusion protein using the C-terminal of Envelope protein (residues 45 to stop) and produced in E. coli. Antigen Sequence MNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV Specificity In lysates of transfected cells with the plasmid containing the sequence used, detects the fusion protein by Western blot. Storage For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours. Special instructions The antibody solution should be gently mixed before use