上游5-TCCGTAAAGACCTCTATGCC,下游引物5-GCTCAGTAACAGTCCGCCTA,大鼠b-actin内对照.原始基因如下:
1: NM_012580. Reports Rattus norvegicus...[gi:61098187] Links
LOCUS NM_012580 1600 bp mRNA linear ROD 07-JUN-2005
DEFINITION Rattus norvegicus heme oxygenase (decycling) 1 (Hmox1), mRNA.
ACCESSION NM_012580
VERSION NM_012580.2 GI:61098187
KEYWORDS .
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
Sciurognathi; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 1600)
AUTHORS Di Filippo,C., Marfella,R., Cuzzocrea,S., Piegari,E.,
Petronella,P., Giugliano,D., Rossi,F. and D'Amico,M.
TITLE Hyperglycemia in streptozotocin-induced diabetic rat increases
infarct size associated with low levels of myocardial HO-1 during
ischemia/reperfusion
JOURNAL Diabetes 54 (3), 803-810 (2005)
PUBMED 15734859
REMARK GeneRIF: This study investigated the role of heme oxygenase (HO)-1
in the cardiac tissue injury of acute ischemia/reperfusion (I/R) in
diabetic streptozotocin (STZ)-induced hyperglycemic rats.
REFERENCE 2 (bases 1 to 1600)
AUTHORS Munoz,A.M., Rey,P., Parga,J., Guerra,M.J. and
Labandeira-Garcia,J.L.
TITLE Glial overexpression of heme oxygenase-1: a histochemical marker
for early stages of striatal damage
JOURNAL J. Chem. Neuroanat. 29 (2), 113-126 (2005)
PUBMED 15652698
REMARK GeneRIF: The results indicate that determination of glial HO-1-ir
is a useful histochemical marker for early stages of striatal
damage.
REFERENCE 3 (bases 1 to 1600)
AUTHORS Liu,X.M., Peyton,K.J., Ensenat,D., Wang,H., Schafer,A.I., Alam,J.
and Durante,W.
TITLE Endoplasmic reticulum stress stimulates heme oxygenase-1 gene
expression in vascular smooth muscle. Role in cell survival
JOURNAL J. Biol. Chem. 280 (2), 872-877 (2005)
PUBMED 15546873
REMARK GeneRIF: capacity of endoplasmic reticulum stress to stimulate the
HO-1/carbon monoxide system provides a novel mechanism by which
this organelle regulates cell survival
REFERENCE 4 (bases 1 to 1600)
AUTHORS Salinas,M., Wang,J., Rosa de Sagarra,M., Martin,D., Rojo,A.I.,
Martin-Perez,J., Ortiz de Montellano,P.R. and Cuadrado,A.
TITLE Protein kinase Akt/PKB phosphorylates heme oxygenase-1 in vitro and
in vivo
JOURNAL FEBS Lett. 578 (1-2), 90-94 (2004)
PUBMED 15581622
REMARK GeneRIF: Results provide the first evidence for a role of the
survival kinase Akt in the regulation of heme oxygenase-1.
REFERENCE 5 (bases 1 to 1600)
AUTHORS Oermann,E., Bidmon,H.J., Witte,O.W. and Zilles,K.
TITLE Effects of 1alpha,25 dihydroxyvitamin D3 on the expression of HO-1
and GFAP in glial cells of the photothrombotically lesioned
cerebral cortex
JOURNAL J. Chem. Neuroanat. 28 (4), 225-238 (2004)
PUBMED 15531134
REMARK GeneRIF: Calcitriol increases expression in Rose Bengal-caused
cerebral thrombosi.
REFERENCE 6 (bases 1 to 1600)
AUTHORS Yang,N.C., Lu,L.H., Kao,Y.H. and Chau,L.Y.
TITLE Heme oxygenase-1 attenuates interleukin-1beta-induced nitric oxide
synthase expression in vascular smooth muscle cells
JOURNAL J. Biomed. Sci. 11 (6), 799-809 (2004)
PUBMED 15591777
REMARK GeneRIF: HO-1 attenuates IL-1beta-induced iNOS gene expression in
vascular smooth muscle cells
REFERENCE 7 (bases 1 to 1600)
AUTHORS Hartsfield,C.L., McMurtry,I.F., Ivy,D.D., Morris,K.G., Vidmar,S.,
Rodman,D.M. and Fagan,K.A.
TITLE Cardioprotective and vasomotor effects of HO activity during acute
and chronic hypoxia
JOURNAL Am. J. Physiol. Heart Circ. Physiol. 287 (5), H2009-H2015 (2004)
PUBMED 15217799
REMARK GeneRIF: Inhibition of HO and carbon monoxide (CO) production does
not exacerbate pulmonary hypertension. Rather, HO and CO may be
involved in mediating pulmonary and systemic vasoreactivity to
acute hypoxia and hypoxia-induced right ventricular function.
REFERENCE 8 (bases 1 to 1600)
AUTHORS Akins,R. Jr., McLaughlin,T., Boyce,R., Gilmour,L. and Gratton,K.
TITLE Exogenous metalloporphyrins alter the organization and function of
cultured neonatal rat heart cells via modulation of heme oxygenase
activity
JOURNAL J. Cell. Physiol. 201 (1), 26-34 (2004)
PUBMED 15281086
REMARK GeneRIF: Treatment of heart cells with heme metabolically inhibited
increased HO activity
REFERENCE 9 (bases 1 to 1600)
AUTHORS Choi,B.M., Kim,Y.M., Jeong,Y.R., Pae,H.O., Song,C.E., Park,J.E.,
Ahn,Y.K. and Chung,H.T.
TITLE Induction of heme oxygenase-1 is involved in anti-proliferative
effects of paclitaxel on rat vascular smooth muscle cells
JOURNAL Biochem. Biophys. Res. Commun. 321 (1), 132-137 (2004)
PUBMED 15358225
REMARK GeneRIF: Paclitaxel induces the expression of HO-1 via the JN
kinase pathway in vascular smooth muscle and that HO-1 expression
might be responsible for the anti-proliferative effect of
paclitaxel on VSMC.
REFERENCE 10 (bases 1 to 1600)
AUTHORS Taille,C., El-Benna,J., Lanone,S., Dang,M.C., Ogier-Denis,E.,
Aubier,M. and Boczkowski,J.
TITLE Induction of heme oxygenase-1 inhibits NAD(P)H oxidase activity by
down-regulating cytochrome b558 expression via the reduction of
heme availability
JOURNAL J. Biol. Chem. 279 (27), 28681-28688 (2004)
PUBMED 15123630
REMARK GeneRIF: heme oxygenase-1 inhibits NAD(P)H oxidase activity by
down-regulating cytochrome b558 expression via the reduction of
heme availability
REFERENCE 11 (bases 1 to 1600)
AUTHORS Kim,H.P., Wang,X., Galbiati,F., Ryter,S.W. and Choi,A.M.
TITLE Caveolae compartmentalization of heme oxygenase-1 in endothelial
cells
JOURNAL FASEB J. 18 (10), 1080-1089 (2004)
PUBMED 15226268
REMARK GeneRIF: HO-1 interacts with caveolin-1 (inhibitory) and localizes
in part to specialized plasma membrane caveolae in rat pulmonary
artery endothelial cells.
REFERENCE 12 (bases 1 to 1600)
AUTHORS Huang,X.L., Ling,Y.L., Ling,Y.Q., Zhou,J.L., Liu,Y. and Wang,Q.H.
TITLE Heme oxygenase-1 in cholecystokinin-octapeptipe attenuated injury
of pulmonary artery smooth muscle cells induced by
lipopolysaccharide and its signal transduction mechanism
JOURNAL World J. Gastroenterol. 10 (12), 1789-1794 (2004)
PUBMED 15188507
REMARK GeneRIF: HO-1 may be a key factor in CCK-8 attenuated injuries of
pulmonary artery smooth muscle cells induced by lipopolysaccharides
REFERENCE 13 (bases 1 to 1600)
AUTHORS Johnson,W.T. and DeMars,L.C.
TITLE Increased heme oxygenase-1 expression during copper deficiency in
rats results from increased mitochondrial generation of hydrogen
peroxide
JOURNAL J. Nutr. 134 (6), 1328-1333 (2004)
PUBMED 15173392
REMARK GeneRIF: Increased mitochondrial H(2)O(2) production resulting from
inhibition of respiratory complex activities contributes to
induction of HO-1 in liver and heart during copper deficiency.
REFERENCE 14 (bases 1 to 1600)
AUTHORS Yang,Z.F., Tsui,T.Y., Ho,D.W., Tang,T.C. and Fan,S.T.
TITLE Heme oxygenase-1 potentiates the survival of small-for-size liver
graft
JOURNAL Liver Transpl. 10 (6), 784-793 (2004)
PUBMED 15162474
REMARK GeneRIF: Beneficial effects of HO-1 on allograft survival. Ability
of small-for-size grafts in induction of HO-1 expression might
facilitate their own survival in liver transplantation.
REFERENCE 15 (bases 1 to 1600)
AUTHORS Takeda,K., Lin,J., Okubo,S., Akazawa-Kudoh,S., Kajinami,K.,
Kanemitsu,S., Tsugawa,H., Kanda,T., Matsui,S. and Takekoshi,N.
TITLE Transient glucose deprivation causes upregulation of heme
oxygenase-1 and cyclooxygenase-2 expression in cardiac fibroblasts
JOURNAL J. Mol. Cell. Cardiol. 36 (6), 821-830 (2004)
PUBMED 15158123
REMARK GeneRIF: briefly removing glucose from cultured cardiac fibroblasts
induces COX-2 and HO-1 expression via generation of ROS and p38
MAPK phosphorylation
REFERENCE 16 (bases 1 to 1600)
AUTHORS Lin,H.C., Cheng,T.H., Chen,Y.C. and Juan,S.H.
TITLE Mechanism of heme oxygenase-1 gene induction by quercetin in rat
aortic smooth muscle cells
JOURNAL Pharmacology 71 (2), 107-112 (2004)
PUBMED 15118350
REMARK GeneRIF: HO-1 induction is beneficial for protecting blood vessels.
that quercetin, a common polyphenolic compound in foods of plant
origin, induces HO-1 expression in RAW264.7 cells.
REFERENCE 17 (bases 1 to 1600)
AUTHORS Attuwaybi,B.O., Kozar,R.A., Moore-Olufemi,S.D., Sato,N.,
Hassoun,H.T., Weisbrodt,N.W. and Moore,F.A.
TITLE Heme oxygenase-1 induction by hemin protects against gut
ischemia/reperfusion injury
JOURNAL J. Surg. Res. 118 (1), 53-57 (2004)
PUBMED 15093717
REMARK GeneRIF: HO-1 plays an important role in protecting the gut against
I/R-induced injury.
REFERENCE 18 (bases 1 to 1600)
AUTHORS Johnson,F.K., Durante,W., Peyton,K.J. and Johnson,R.A.
TITLE Heme oxygenase-mediated endothelial dysfunction in DOCA-salt, but
not in spontaneously hypertensive, rat arterioles
JOURNAL Am. J. Physiol. Heart Circ. Physiol. 286 (5), H1681-H1687 (2004)
PUBMED 14693679
REMARK GeneRIF: Elevated HO-1 levels and activity, not resulting from
hypertension per se, contribute to endothelial dysfunction in DOCA
rats.
REFERENCE 19 (bases 1 to 1600)
AUTHORS Chen,Y.C., Gines,P., Yang,J., Summer,S.N., Falk,S., Russell,N.S.
and Schrier,R.W.
TITLE Increased vascular heme oxygenase-1 expression contributes to
arterial vasodilation in experimental cirrhosis in rats
JOURNAL Hepatology 39 (4), 1075-1087 (2004)
PUBMED 15057912
REMARK GeneRIF: increased expression of HO-1 was found in aorta and
mesenteric arteries of bile duct ligation rats in a close
chronologic relationship with the progression from acute
cholestatic liver injury to fully developed cirrhosis with arterial
vasodilation
REFERENCE 20 (bases 1 to 1600)
AUTHORS Komatsu,D.E. and Hadjiargyrou,M.
TITLE Activation of the transcription factor HIF-1 and its target genes,
VEGF, HO-1, iNOS, during fracture repair
JOURNAL Bone 34 (4), 680-688 (2004)
PUBMED 15050899
REMARK GeneRIF: expression pattern of HIF-1alpha and selected HIF-1 target
genes using a rat femoral fracture model
REFERENCE 21 (bases 1 to 1600)
AUTHORS Li Volti,G., Ientile,R., Abraham,N.G., Vanella,A., Cannavo,G.,
Mazza,F., Curro,M., Raciti,G., Avola,R. and Campisi,A.
TITLE Immunocytochemical localization and expression of heme oxygenase-1
in primary astroglial cell cultures during differentiation: effect
of glutamate
JOURNAL Biochem. Biophys. Res. Commun. 315 (2), 517-524 (2004)
PUBMED 14766239
REMARK GeneRIF: HO-1 protein expression and localization in primary
cultured astroglial cells may be part of the underlying mechanisms
involved in brain development as well as in neurodegenerative
disease
REFERENCE 22 (bases 1 to 1600)
AUTHORS Quan,S., Kaminski,P.M., Yang,L., Morita,T., Inaba,M., Ikehara,S.,
Goodman,A.I., Wolin,M.S. and Abraham,N.G.
TITLE Heme oxygenase-1 prevents superoxide anion-associated endothelial
cell sloughing in diabetic rats
JOURNAL Biochem. Biophys. Res. Commun. 315 (2), 509-516 (2004)
PUBMED 14766238
REMARK GeneRIF: HO-1 in diabetic rats regulates levels of serum bilirubin,
O(*-)(2) production, and endothelial cell sloughing
REFERENCE 23 (bases 1 to 1600)
AUTHORS Li,Q.F. and Dai,A.G.
TITLE Hypoxia inducible factor-1 alpha correlates the expression of heme
oxygenase 1 gene in pulmonary arteries of rat with hypoxia-induced
pulmonary hypertension
JOURNAL Acta Biochim. Biophys. Sin. (Shanghai) 36 (2), 133-140 (2004)
PUBMED 14970910
REMARK GeneRIF: HIF-1alpha and HO-1 are involved in the pathogenesis of
hypoxia-induced pulmonary hypertension in rat
REFERENCE 24 (bases 1 to 1600)
AUTHORS Oztezcan,S., Kirgiz,B., Unlucerci,Y., Dogru-Abbasoglu,S., Bilge,H.,
Uysal,M. and Aykac-Toker,G.
TITLE Heme oxygenase induction protects liver against oxidative stress in
x-irradiated aged rats
JOURNAL Biogerontology 5 (2), 99-105 (2004)
PUBMED 15105584
REMARK GeneRIF: These results suggest that oxidative stress produced in
irradiated rats may be compensated by heme oxygenase-1 induction.
REFERENCE 25 (bases 1 to 1600)
AUTHORS Weng,Y.H., Yang,G., Weiss,S. and Dennery,P.A.
TITLE Interaction between heme oxygenase-1 and -2 proteins
JOURNAL J. Biol. Chem. 278 (51), 50999-51005 (2003)
PUBMED 14514669
REMARK GeneRIF: demonstrated an interaction between Hmox1 and Hmox2 at
amino acids 0-45 of Hmox2 and amino acids 58-80 of Hmox1,
corresponding to a highly conserved, hydrophilic, and exposed
region of the protein
REFERENCE 26 (bases 1 to 1600)
AUTHORS Farhangkhoee,H., Khan,Z.A., Mukherjee,S., Cukiernik,M.,
Barbin,Y.P., Karmazyn,M. and Chakrabarti,S.
TITLE Heme oxygenase in diabetes-induced oxidative stress in the heart
JOURNAL J. Mol. Cell. Cardiol. 35 (12), 1439-1448 (2003)
PUBMED 14654370
REMARK GeneRIF: Ho-1 level increased in cardiac myocytes one-month after
diabetes mellitus.
REFERENCE 27 (bases 1 to 1600)
AUTHORS Zhang,J., Ling,Y., Luo,B., Tang,L., Ryter,S.W., Stockard,C.R.,
Grizzle,W.E. and Fallon,M.B.
TITLE Analysis of pulmonary heme oxygenase-1 and nitric oxide synthase
alterations in experimental hepatopulmonary syndrome
JOURNAL Gastroenterology 125 (5), 1441-1451 (2003)
PUBMED 14598260
REMARK GeneRIF: The heme oxygenase-1/carbon monoxide system is an
important contributor to the progression of experimental
hepatopulmonary syndrome in addition to alterations in the
endothelial nitric oxide synthase/nitric oxide pathway.
REFERENCE 28 (bases 1 to 1600)
AUTHORS Attuwaybi,B.O., Hassoun,H.T., Zou,L., Kozar,R.A., Kone,B.C.,
Weisbrodt,N.W. and Moore,F.A.
TITLE Hypothermia protects against gut ischemia/reperfusion-induced
impaired intestinal transit by inducing heme oxygenase-1
JOURNAL J. Surg. Res. 115 (1), 48-55 (2003)
PUBMED 14572772
REMARK GeneRIF: intraischemic regional hypothermia protects against
histological injury and impaired intestinal transit caused by
severe gut ischemia-reperfusion injury in part due to heme
oxygenase-1 expression
REFERENCE 29 (bases 1 to 1600)
AUTHORS Patel,J., Manjappa,N., Bhat,R., Mehrotra,P., Bhaskaran,M. and
Singhal,P.C.
TITLE Role of oxidative stress and heme oxygenase activity in
morphine-induced glomerular epithelial cell growth
JOURNAL Am. J. Physiol. Renal Physiol. 285 (5), F861-F869 (2003)
PUBMED 12812915
REMARK GeneRIF: Heme oxygenase activity is directly related to glomerular
epithelial cell(GEC) apoptosis and inversely related to GEC
proliferation. Morphine had dose-related effects on HO activity. HO
activity may be modifying morphine-induced GEC growth.
REFERENCE 30 (bases 1 to 1600)
AUTHORS Liu,H., Nowak,R., Chao,W. and Bloch,K.D.
TITLE Nerve growth factor induces anti-apoptotic heme oxygenase-1 in rat
pheochromocytoma PC12 cells
JOURNAL J. Neurochem. 86 (6), 1553-1563 (2003)
PUBMED 12950464
REMARK GeneRIF: NGF enhances HO-1 gene transcription via MEK activation
and that the induction of HO-1 plays an important role in the
antioxidative and antiapoptotic effects of NGF in serum-deprived
PC12 cells
REFERENCE 31 (bases 1 to 1600)
AUTHORS Ke,B., Shen,X.D., Lassman,C.R., Gao,F., Busuttil,R.W. and
Kupiec-Weglinski,J.W.
TITLE Cytoprotective and antiapoptotic effects of IL-13 in hepatic cold
ischemia/reperfusion injury are heme oxygenase-1 dependent
JOURNAL Am J Transplant 3 (9), 1076-1082 (2003)
PUBMED 12919086
REMARK GeneRIF: Inhibition of HO-1 with tin protoporphyrin reversed
cytoprotective/antiapoptotic effects of IL-13 in liver
transplantation.
REFERENCE 32 (bases 1 to 1600)
AUTHORS Jonas,J.C., Guiot,Y., Rahier,J. and Henquin,J.C.
TITLE Haeme-oxygenase 1 expression in rat pancreatic beta cells is
stimulated by supraphysiological glucose concentrations and by
cyclic AMP
JOURNAL Diabetologia 46 (9), 1234-1244 (2003)
PUBMED 12898011
REMARK GeneRIF: High glucose concentrations and cyclic AMP increase
beta-cell HO1 protein expression/
REFERENCE 33 (bases 1 to 1600)
AUTHORS Wang,T., Sterling,H., Shao,W.A., Yan,Q., Bailey,M.A., Giebisch,G.
and Wang,W.H.
TITLE Inhibition of heme oxygenase decreases sodium and fluid absorption
in the loop of Henle
JOURNAL Am. J. Physiol. Renal Physiol. 285 (3), F484-F490 (2003)
PUBMED 12890663
REMARK GeneRIF: high-potassium intake increases HO-2 expression in the
kidney and that HO-dependent metabolites of heme, presumably CO,
play a significant role in the regulation of Na+ transport in the
loop of Henle
REFERENCE 34 (bases 1 to 1600)
AUTHORS Sugishima,M., Sakamoto,H., Higashimoto,Y., Noguchi,M. and
Fukuyama,K.
TITLE Crystal structure of rat heme oxygenase-1 in complex with
biliverdin-iron chelate. Conformational change of the distal helix
during the heme cleavage reaction
JOURNAL J. Biol. Chem. 278 (34), 32352-32358 (2003)
PUBMED 12794075
REMARK GeneRIF: crystal structure in complex with biliverdin-iron chelate
REFERENCE 35 (bases 1 to 1600)
AUTHORS Gong,P., Cederbaum,A.I. and Nieto,N.
TITLE Increased expression of cytochrome P450 2E1 induces heme
oxygenase-1 through ERK MAPK pathway
JOURNAL J. Biol. Chem. 278 (32), 29693-29700 (2003)
PUBMED 12777398
REMARK GeneRIF: heme oxygenase 1 is induced by P4502E1 through ERK MAPK
pathway
REFERENCE 36 (bases 1 to 1600)
AUTHORS Araujo,J.A., Meng,L., Tward,A.D., Hancock,W.W., Zhai,Y., Lee,A.,
Ishikawa,K., Iyer,S., Buelow,R., Busuttil,R.W., Shih,D.M.,
Lusis,A.J. and Kupiec-Weglinski,J.W.
TITLE Systemic rather than local heme oxygenase-1 overexpression improves
cardiac allograft outcomes in a new transgenic mouse
JOURNAL J. Immunol. 171 (3), 1572-1580 (2003)
PUBMED 12874251
REMARK GeneRIF: Hearts transplanted into heme oxygenase-1 transgenic mice
recipients show decreased CD4+ lymphocyte infiltration and
diminished immune activation, as judged by CD25 expression.
REFERENCE 37 (bases 1 to 1600)
AUTHORS Guo,J.S., Cho,C.H., Wang,W.P., Shen,X.Z., Cheng,C.L. and Koo,M.W.
TITLE Expression and activities of three inducible enzymes in the healing
of gastric ulcers in rats
JOURNAL World J. Gastroenterol. 9 (8), 1767-1771 (2003)
PUBMED 12918117
REMARK GeneRIF: xpression and activities of inducible NOS, HO-1 and COX-2
are found to be correlated to different stages of gastric
ulceration. Inducible NOS may contribute to ulcer formation while
HO-1 and COX-2 may promote ulcer healing.
REFERENCE 38 (bases 1 to 1600)
AUTHORS Bechtold,D.A. and Brown,I.R.
TITLE Induction of Hsp27 and Hsp32 stress proteins and vimentin in glial
cells of the rat hippocampus following hyperthermia
JOURNAL Neurochem. Res. 28 (8), 1163-1173 (2003)
PUBMED 12834255
REMARK GeneRIF: induction in glial cells of hippocampus following
hyperthermia (Hsp32).
REFERENCE 39 (bases 1 to 1600)
AUTHORS Kreiser,D., Kelly,D.K., Seidman,D.S., Stevenson,D.K., Baum,M. and
Dennery,P.A.
TITLE Gestational pattern of heme oxygenase expression in the rat
JOURNAL Pediatr. Res. 54 (2), 172-178 (2003)
PUBMED 12736392
REMARK GeneRIF: In the uterus, HO-1 and HO-2 protein and total mRNA levels
peaked on d 16 of pregnancy, whereas, in the placenta, HO-1 and
HO-2 protein levels peaked on d 19.
REFERENCE 40 (bases 1 to 1600)
AUTHORS Wagener,F.A., van Beurden,H.E., von den Hoff,J.W., Adema,G.J. and
Figdor,C.G.
TITLE The heme-heme oxygenase system: a molecular switch in wound healing
JOURNAL Blood 102 (2), 521-528 (2003)
PUBMED 12649161
REMARK GeneRIF: HO-1 is made in mucosal & skin epithelia of animals
without wounds. On inflammation, expression increased, particularly
in infiltrating cells during resolution. HO-1 antagonizes
inflammation by attenuating adhesive interactions & cellular
infiltration.
REFERENCE 41 (bases 1 to 1600)
AUTHORS Noriega,G.O., Tomaro,M.L. and del Batlle,A.M.
TITLE Bilirubin is highly effective in preventing in vivo
delta-aminolevulinic acid-induced oxidative cell damage
JOURNAL Biochim. Biophys. Acta 1638 (2), 173-178 (2003)
PUBMED 12853123
REFERENCE 42 (bases 1 to 1600)
AUTHORS Tsui,T.Y., Wu,X., Lau,C.K., Ho,D.W., Xu,T., Siu,Y.T. and Fan,S.T.
TITLE Prevention of chronic deterioration of heart allograft by
recombinant adeno-associated virus-mediated heme oxygenase-1 gene
transfer
JOURNAL Circulation 107 (20), 2623-2629 (2003)
PUBMED 12732603
REMARK GeneRIF: Recombinant adeno-associated virus-mediated heme
oxygenase-1 gene transfer represents a novel therapeutic approach
to prevent chronic allograft deterioration in clinical heart
transplantation
REFERENCE 43 (bases 1 to 1600)
AUTHORS Kietzmann,T., Samoylenko,A. and Immenschuh,S.
TITLE Transcriptional regulation of heme oxygenase-1 gene expression by
MAP kinases of the JNK and p38 pathways in primary cultures of rat
hepatocytes
JOURNAL J. Biol. Chem. 278 (20), 17927-17936 (2003)
PUBMED 12637567
REMARK GeneRIF: the HO-1 CRE/AP-1 element mediates HO-1 gene induction via
activation of JNK/c-Jun whereas p38 isoforms act through a
different mechanism via the E-box
REFERENCE 44 (bases 1 to 1600)
AUTHORS Watanabe,T., Hasegawa,G., Yamamoto,T., Hatakeyama,K., Suematsu,M.
and Naito,M.
TITLE Expression of heme oxygenase-1 in rat ontogeny
JOURNAL Arch. Histol. Cytol. 66 (2), 155-162 (2003)
PUBMED 12846555
REMARK GeneRIF: Hmox1 expression was studied in rat ontogeny.
REFERENCE 45 (bases 1 to 1600)
AUTHORS Masini,E., Vannacci,A., Marzocca,C., Pierpaoli,S., Giannini,L.,
Fantappie,O., Mazzanti,R. and Mannaioni,P.F.
TITLE Heme oxygenase-1 and the ischemia-reperfusion injury in the rat
heart
JOURNAL Exp. Biol. Med. (Maywood) 228 (5), 546-549 (2003)
PUBMED 12709584
REMARK GeneRIF: Data show that induction of heme oxygenase-1 by hemin
significantly decreased infarct size, incidence of reperfusion
arrhythmias, malondialdehyde generation, and calcium overload
induced by focal ischemia-reperfusion in the rat heart.
REFERENCE 46 (bases 1 to 1600)
AUTHORS Mingone,C.J., Gupte,S.A., Quan,S., Abraham,N.G. and Wolin,M.S.
TITLE Influence of heme and heme oxygenase-1 transfection of pulmonary
microvascular endothelium on oxidant generation and cGMP
JOURNAL Exp. Biol. Med. (Maywood) 228 (5), 535-539 (2003)
PUBMED 12709582
REMARK GeneRIF: Data suggest that heme and heme oxygenase-1 regulate
soluble guanylate cyclase through mechanisms involving nitric oxide
and carbon monoxide.
REFERENCE 47 (bases 1 to 1600)
AUTHORS Colombrita,C., Calabrese,V., Stella,A.M., Mattei,F., Alkon,D.L. and
Scapagnini,G.
TITLE Regional rat brain distribution of heme oxygenase-1 and manganese
superoxide dismutase mRNA: relevance of redox homeostasis in the
aging processes
JOURNAL Exp. Biol. Med. (Maywood) 228 (5), 517-524 (2003)
PUBMED 12709579
REMARK GeneRIF: Results describe age-dependent differences in heme
oxygenase-1 and manganese superoxide dismutase-2 expression in rat
brain.
REFERENCE 48 (bases 1 to 1600)
AUTHORS Mostert,V., Hill,K.E., Ferris,C.D. and Burk,R.F.
TITLE Selective induction of liver parenchymal cell heme oxygenase-1 in
selenium-deficient rats
JOURNAL Biol. Chem. 384 (4), 681-687 (2003)
PUBMED 12751798
REMARK GeneRIF: selenium deficiency affects hepatic antioxidant
selenoproteins, resulting in an up-regulation of heme oxygenase 1
REFERENCE 49 (bases 1 to 1600)
AUTHORS Alam,J., Killeen,E., Gong,P., Naquin,R., Hu,B., Stewart,D.,
Ingelfinger,J.R. and Nath,K.A.
TITLE Heme activates the heme oxygenase-1 gene in renal epithelial cells
by stabilizing Nrf2
JOURNAL Am. J. Physiol. Renal Physiol. 284 (4), F743-F752 (2003)
PUBMED 12453873
REMARK GeneRIF: Expression of HO-1 is activated by heme in immortalized
rat proximal tubular epithelial cells
REFERENCE 50 (bases 1 to 1600)
AUTHORS Kanakiriya,S.K., Croatt,A.J., Haggard,J.J., Ingelfinger,J.R.,
Tang,S.S., Alam,J. and Nath,K.A.
TITLE Heme: a novel inducer of MCP-1 through HO-dependent and
HO-independent mechanisms
JOURNAL Am. J. Physiol. Renal Physiol. 284 (3), F546-F554 (2003)
PUBMED 12556365
REMARK GeneRIF: Hemin elicited a dose- and time-dependent induction of
HO-1 and MCP-1 mRNA in rat proximal tubular epithelial cells
REFERENCE 51 (bases 1 to 1600)
AUTHORS Suzuki,M., Iso-o,N., Take***a,S., Tsukamoto,K., Mori,I., Sato,T.,
Ohno,M., Nagai,R. and Ishizaka,N.
TITLE Facilitated angiogenesis induced by heme oxygenase-1 gene transfer
in a rat model of hindlimb ischemia
JOURNAL Biochem. Biophys. Res. Commun. 302 (1), 138-143 (2003)
PUBMED 12593860
REMARK GeneRIF: role in facilitating angiogenesis in model of hindlimb
ischemia
REFERENCE 52 (bases 1 to 1600)
AUTHORS Johnson,F.K., Durante,W., Peyton,K.J. and Johnson,R.A.
TITLE Heme oxygenase inhibitor restores arteriolar nitric oxide function
in dahl rats
JOURNAL Hypertension 41 (1), 149-155 (2003)
PUBMED 12511545
REFERENCE 53 (bases 1 to 1600)
AUTHORS Kukoba,T.V., Moibenko,O.O. and Kotsioruba,A.V.
TITLE [Cardioprotective effect of heme oxygenase-1 induction by hemin on
the isolated rat heart during ischemia--reperfusion]
JOURNAL Fiziol Zh 49 (6), 14-21 (2003)
PUBMED 14965033
REMARK GeneRIF: HO-1 confers cardiprotection to the isolated rat heart
during ischemia-reperfusion.
REFERENCE 54 (bases 1 to 1600)
AUTHORS Warskulat,U., Gorg,B., Bidmon,H.J., Muller,H.W., Schliess,F. and
Haussinger,D.
TITLE Ammonia-induced heme oxygenase-1 expression in cultured rat
astrocytes and rat brain in vivo
JOURNAL Glia 40 (3), 324-336 (2002)
PUBMED 12420312
REMARK GeneRIF: HO-1 mRNA levels were upregulated by ammonia after 24 h
and protein expression after 72 h in astrocytes. These effects on
HO-1 are probably triggered by ammonia-induced glutamine synthesis
or by astrocyte swelling.
REFERENCE 55 (bases 1 to 1600)
AUTHORS Sugishima,M., Sakamoto,H., Higashimoto,Y., Omata,Y., Hayashi,S.,
Noguchi,M. and Fukuyama,K.
TITLE Crystal structure of rat heme oxygenase-1 in complex with heme
bound to azide. Implication for regiospecific hydroxylation of heme
at the alpha-meso carbon
JOURNAL J. Biol. Chem. 277 (47), 45086-45090 (2002)
PUBMED 12235152
REMARK GeneRIF: Results describe the crystal structure of rat heme
oxygenase 1 (HO-1) in complex with heme and azide (HO-heme-N(3)(-))
at 1.9-A resolution.
REFERENCE 56 (bases 1 to 1600)
AUTHORS Miyazono,M., Garat,C., Morris,K.G. Jr. and Carter,E.P.
TITLE Decreased renal heme oxygenase-1 expression contributes to
decreased renal function during cirrhosis
JOURNAL Am. J. Physiol. Renal Physiol. 283 (5), F1123-F1131 (2002)
PUBMED 12372789
REMARK GeneRIF: decreased renal HO-1 expression contributes to
deteriorated renal function and hemodynamics during cirrhosis.
REFERENCE 57 (bases 1 to 1600)
AUTHORS Naughton,P., Foresti,R., Bains,S.K., Hoque,M., Green,C.J. and
Motterlini,R.
TITLE Induction of heme oxygenase 1 by nitrosative stress. A role for
nitroxyl anion
JOURNAL J. Biol. Chem. 277 (43), 40666-40674 (2002)
PUBMED 12194971
REMARK GeneRIF: role of nitroxyl anion in inducing heme oxygenase 1
REFERENCE 58 (bases 1 to 1600)
AUTHORS Ke,B., Shen,X.D., Zhai,Y., Gao,F., Busuttil,R.W., Volk,H.D. and
Kupiec-Weglinski,J.W.
TITLE Heme oxygenase 1 mediates the immunomodulatory and antiapoptotic
effects of interleukin 13 gene therapy in vivo and in vitro
JOURNAL Hum. Gene Ther. 13 (15), 1845-1857 (2002)
PUBMED 12396617
REMARK GeneRIF: Heme oxygenase 1 mediates the immunomodulatory and
antiapoptotic effects of interleukin 13 gene therapy in vivo in
rats and in vitro in human cells.
REFERENCE 59 (bases 1 to 1600)
AUTHORS Lakkisto,P., Palojoki,E., Backlund,T., Saraste,A., Tikkanen,I.,
Voipio-Pulkki,L.M. and Pulkki,K.
TITLE Expression of heme oxygenase-1 in response to myocardial infarction
in rats
JOURNAL J. Mol. Cell. Cardiol. 34 (10), 1357-1365 (2002)
PUBMED 12392996
REMARK GeneRIF: expression and localization of HO-1 in a rat experimental
myocardial infarction model
REFERENCE 60 (bases 1 to 1600)
AUTHORS Zhang,X., Bedard,E.L., Potter,R., Zhong,R., Alam,J., Choi,A.M. and
Lee,P.J.
TITLE Mitogen-activated protein kinases regulate HO-1 gene transcription
after ischemia-reperfusion lung injury
JOURNAL Am. J. Physiol. Lung Cell Mol. Physiol. 283 (4), L815-L829 (2002)
PUBMED 12225959
REFERENCE 61 (bases 1 to 1600)
AUTHORS Bak,I., Papp,G., Turoczi,T., Varga,E., Szendrei,L., Vecsernyes,M.,
Joo,F. and Tosaki,A.
TITLE The role of heme oxygenase-related carbon monoxide and ventricular
fibrillation in ischemic/reperfused hearts
JOURNAL Free Radic. Biol. Med. 33 (5), 639-648 (2002)
PUBMED 12208350
REMARK GeneRIF: heme oxygenase has a role in prevention of reperfusion
ventricular fibrillation via an increase in endogenous carbon
monoxide production
REFERENCE 62 (bases 1 to 1600)
AUTHORS Ndisang,J.F., Zhao,W. and Wang,R.
TITLE Selective regulation of blood pressure by heme oxygenase-1 in
hypertension
JOURNAL Hypertension 40 (3), 315-321 (2002)
PUBMED 12215473
REMARK GeneRIF: regulation of blood pressure by heme oxygenase-1 in
hypertension
REFERENCE 63 (bases 1 to 1600)
AUTHORS Tamion,F., Richard,V., Lacoume,Y. and Thuillez,C.
TITLE Intestinal preconditioning prevents systemic inflammatory response
in hemorrhagic shock. Role of HO-1
JOURNAL Am. J. Physiol. Gastrointest. Liver Physiol. 283 (2), G408-G414
(2002)
PUBMED 12121889
REFERENCE 64 (bases 1 to 1600)
AUTHORS Carter,E.P., Hartsfield,C.L., Miyazono,M., Jakkula,M., Morris,K.G.
Jr. and McMurtry,I.F.
TITLE Regulation of heme oxygenase-1 by nitric oxide during
hepatopulmonary syndrome
JOURNAL Am. J. Physiol. Lung Cell Mol. Physiol. 283 (2), L346-L353 (2002)
PUBMED 12114196
REFERENCE 65 (bases 1 to 1600)
AUTHORS Yang,G., Shegog,M.L. and Dennery,P.A.
TITLE Effect of glutathione on lung activator protein-1 activation and
heme oxygenase-1 induction in the immature rat
JOURNAL Pediatr. Res. 52 (1), 34-39 (2002)
PUBMED 12084844
REMARK GeneRIF: the neonatal lung is relatively resistant to AP-1
activation and Heme oxygenase-1 induction by GSH perturbation.
REFERENCE 66 (bases 1 to 1600)
AUTHORS Peyton,K.J., Reyna,S.V., Chapman,G.B., Ensenat,D., Liu,X.M.,
Wang,H., Schafer,A.I. and Durante,W.
TITLE Heme oxygenase-1-derived carbon monoxide is an autocrine inhibitor
of vascular smooth muscle cell growth
JOURNAL Blood 99 (12), 4443-4448 (2002)
PUBMED 12036874
REMARK GeneRIF: Heme oxygenase-1-derived carbon monoxide is an autocrine
inhibitor of vascular smooth muscle cell growth.
REFERENCE 67 (bases 1 to 1600)
AUTHORS Sugishima,M., Sakamoto,H., Kakuta,Y., Omata,Y., Hayashi,S.,
Noguchi,M. and Fukuyama,K.
TITLE Crystal structure of rat apo-heme oxygenase-1 (HO-1): mechanism of
heme binding in HO-1 inferred from structural comparison of the apo
and heme complex forms
JOURNAL Biochemistry 41 (23), 7293-7300 (2002)
PUBMED 12044160
REMARK GeneRIF: The structural features of apo-heme oxygenase-1 (HO-1)
suggest that the orientation of the proximal helix and the position
of His25 (the proximal ligand of heme) are fixed upon heme binding.
REFERENCE 68 (bases 1 to 1600)
AUTHORS Zhang,M., Zhang,B.H., Chen,L. and An,W.
TITLE Overexpression of heme oxygenase-1 protects smooth muscle cells
against oxidative injury and inhibits cell proliferation
JOURNAL Cell Res. 12 (2), 123-132 (2002)
PUBMED 12118938
REMARK GeneRIF: HO-1 is potentially able to reduce the risk factors of
atherosclerosis, partially due to its cellular protection against
oxidative injury and to its inhibitory effect on cellular
proliferation
REFERENCE 69 (bases 1 to 1600)
AUTHORS Kreiser,D., Nguyen,X., Wong,R., Seidman,D., Stevenson,D., Quan,S.,
Abraham,N. and Dennery,P.A.
TITLE Heme oxygenase-1 modulates fetal growth in the rat
JOURNAL Lab. Invest. 82 (6), 687-692 (2002)
PUBMED 12065678
REMARK GeneRIF: In rats, heme oxygenase-1 modulates fetal growth by its
effect on placental growth factors.
REFERENCE 70 (bases 1 to 1600)
AUTHORS Koike,E., Hirano,S., Shimojo,N. and Kobayashi,T.
TITLE cDNA microarray analysis of gene expression in rat alveolar
macrophages in response to organic extract of diesel exhaust
particles
JOURNAL Toxicol. Sci. 67 (2), 241-246 (2002)
PUBMED 12011483
REMARK GeneRIF: Exposure to diesel exhaust particles elevated
transcription of heme oxygenase-1 gene in rat alveolar macrophages.
REFERENCE 71 (bases 1 to 1600)
AUTHORS Almeida,C. and Branco,S.
TITLE Role of the haem oxygenase-carbon monoxide pathway in
insulin-induced hypothermia: evidence for carbon monoxide
involvement
JOURNAL Pflugers Arch. 444 (1-2), 244-250 (2002)
PUBMED 11976938
REMARK GeneRIF: carbon monoxide is the heme oxygenase product involved in
the thermoregulatory effect of insulin-induced hypothermia
REFERENCE 72 (bases 1 to 1600)
AUTHORS Hori,R., Kashiba,M., Toma,T., Yachie,A., Goda,N., Makino,N.,
Soejima,A., Nagasawa,T., Nakabayashi,K. and Suematsu,M.
TITLE Gene transfection of H25A mutant heme oxygenase-1 protects cells
against hydroperoxide-induced cytotoxicity
JOURNAL J. Biol. Chem. 277 (12), 10712-10718 (2002)
PUBMED 11786534
REMARK GeneRIF: Gene transfection of H25A mutant heme oxygenase-1 protects
cells against hydroperoxide-induced cytotoxicity
REFERENCE 73 (bases 1 to 1600)
AUTHORS Masuko,Y.
TITLE [Impact of stress response genes induced by L-glutamine on warm
ischemia and reperfusion injury in the rat small intestine]
JOURNAL Hokkaido Igaku Zasshi 77 (2), 169-183 (2002)
PUBMED 11968853
REMARK GeneRIF: has an anti-oxidative function
REFERENCE 74 (bases 1 to 1600)
AUTHORS Steiner,A.A. and Branco,L.G.
TITLE Role of the preoptic carbon monoxide pathway in endotoxin fever in
rats
JOURNAL Brain Res. 927 (1), 27-34 (2002)
PUBMED 11814429
REMARK GeneRIF: Heme Oxygenase-Carbon monoxide pathway in the preoptic
region of the anterior hypothalamus is not involved in fever
REFERENCE 75 (bases 1 to 1600)
AUTHORS Ozawa,N., Goda,N., Makino,N., Yamaguchi,T., Yoshimura,Y. and
Suematsu,M.
TITLE Leydig cell-derived heme oxygenase-1 regulates apoptosis of
premeiotic germ cells in response to stress
JOURNAL J. Clin. Invest. 109 (4), 457-467 (2002)
PUBMED 11854317
REFERENCE 76 (bases 1 to 1600)
AUTHORS Shepard,M., Dhulipala,P., Kabaria,S., Abraham,N.G. and Lianos,E.A.
TITLE Heme oxygenase-1 localization in the rat nephron
JOURNAL Nephron 92 (3), 660-664 (2002)
PUBMED 12372951
REMARK GeneRIF: distal and collecting tubular cells were identified as the
main segments of the nephron that express HO-1 so that the distal
nephron may be less vulnerable to oxidative injury.
REFERENCE 77 (bases 1 to 1600)
AUTHORS Sahlas,D.J., Liberman,A. and Schipper,H.M.
TITLE Role of heme oxygenase-1 in the biogenesis of corpora amylacea
JOURNAL Biogerontology 3 (4), 223-231 (2002)
PUBMED 12232504
REMARK GeneRIF: Role of heme oxygenase-1 in the biogenesis of corpora
amylacea
REFERENCE 78 (bases 1 to 1600)
AUTHORS Kato,H., Amersi,F., Buelow,R., Melinek,J., Coito,A.J., Ke,B.,
Busuttil,R.W. and Kupiec-Weglinski,J.W.
TITLE Heme oxygenase-1 overexpression protects rat livers from
ischemia/reperfusion injury with extended cold preservation
JOURNAL Am J Transplant 1 (2), 121-128 (2001)
PUBMED 12099359
REMARK GeneRIF: overexpression protects rat livers from
ischemia/reperfusion injury with extended cold preservation
REFERENCE 79 (bases 1 to 1600)
AUTHORS Maines,M.D. and Panahian,N.
TITLE The heme oxygenase system and cellular defense mechanisms. Do HO-1
and HO-2 have different functions?
JOURNAL Adv. Exp. Med. Biol. 502, 249-272 (2001)
PUBMED 11950143
REMARK GeneRIF: HO-1 may afford protection against tissue damage by prompt
response to the increased demand for heme catalysis, as well as
contribution to controlled cell death through intrinsic suicide
program
REFERENCE 80 (bases 1 to 1600)
AUTHORS Datta,P.K., Koukouritaki,S.B., Hopp,K.A. and Lianos,E.A.
TITLE Heme oxygenase-1 induction attenuates inducible nitric oxide
synthase expression and proteinuria in glomerulonephritis
JOURNAL J. Am. Soc. Nephrol. 10 (12), 2540-2550 (1999)
PUBMED 10589693
REMARK GeneRIF: Heme oxygenase-1 induction attenuates inducible nitric
oxide synthase expression and proteinuria in glomerulonephritis.
REFERENCE 81 (bases 1 to 1600)
AUTHORS Muller,R.M., Taguchi,H. and Shibahara,S.
TITLE Nucleotide sequence and organization of the rat heme oxygenase gene
JOURNAL J. Biol. Chem. 262 (14), 6795-6802 (1987)
PUBMED 3032976
REFERENCE 82 (bases 1 to 1600)
AUTHORS Shibahara,S., Muller,R., Taguchi,H. and Yoshida,T.
TITLE Cloning and expression of cDNA for rat heme oxygenase
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 82 (23), 7865-7869 (1985)
PUBMED 3865203
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from BC091164.1.
On Mar 13, 2005 this sequence version replaced gi:6981031.
SUMMARY: catalyzes the oxidative cleavage of heme to biliverdin
[RGD].
FEATURES Location/Qualifiers
source 1..1600
/organism="Rattus norvegicus"
/mol_type="mRNA"
/db_xref="taxon:10116"
/chromosome="19"
/map="19p11"
gene 1..1600
/gene="Hmox1"
/note="synonyms: Ho1, Heox, Hmox, Ho-1, HEOXG, hsp32"
/db_xref="GeneID:24451"
/db_xref="RATMAP:34040"
/db_xref="RGD:2806"
CDS 117..986
/gene="Hmox1"
/note="heme oxygenase 1; Heme oxygenase 1;
go_component: microsome [goid 0005792] [evidence IEA];
go_component: plasma membrane [goid 0005886] [evidence
IEA];
go_component: membrane fraction [goid 0005624] [evidence
IEA];
go_component: plasma membrane [goid 0005886] [evidence
TAS] [pmid 12511545];
go_component: integral to membrane [goid 0016021]
[evidence IEA];
go_component: endoplasmic reticulum [goid 0005783]
[evidence IEA];
go_function: heme binding [goid 0020037] [evidence IEA];
go_function: heme binding [goid 0020037] [evidence IDA]
[pmid 12044160];
go_function: oxidoreductase activity [goid 0016491]
[evidence IEA];
go_function: phospholipase D activity [goid 0004630]
[evidence IEA];
go_function: signal transducer activity [goid 0004871]
[evidence IEA];
go_function: oxidoreductase activity [goid 0016491]
[evidence IDA] [pmid 12114196];
go_function: phospholipase D activity [goid 0004630]
[evidence IDA] [pmid 12511545];
go_function: heme oxygenase (decyclizing) activity [goid
0004392] [evidence IEA];
go_function: heme oxygenase (decyclizing) activity [goid
0004392] [evidence IDA] [pmid 11854317];
go_function: heme oxygenase (decyclizing) activity [goid
0004392] [evidence TAS] [pmid 12114196];
go_process: heme oxidation [goid 0006788] [evidence IEA];
go_process: heme oxidation [goid 0006788] [evidence TAS]
[pmid 12114196];
go_process: response to stimulus [goid 0050896] [evidence
IEA];
go_process: phospholipid metabolism [goid 0006644]
[evidence IEA];
go_process: phospholipid metabolism [goid 0006644]
[evidence TAS] [pmid 12511545];
go_process: intracellular signaling cascade [goid 0007242]
[evidence IDA] [pmid 12225959];
go_process: small GTPase mediated signal transduction
[goid 0007264] [evidence IEA];
go_process: small GTPase mediated signal transduction
[goid 0007264] [evidence IDA] [pmid 12511545];
go_process: positive regulation of I-kappaB
kinase/NF-kappaB cascade [goid 0043123] [evidence IEA];
go_process: DNA damage response, signal transduction
resulting in induction of apoptosis [goid 0008630]
[evidence IEA];
go_process: DNA damage response, signal transduction
resulting in induction of apoptosis [goid 0008630]
[evidence IDA] [pmid 11854317]"
/codon_start=1
/product="heme oxygenase (decycling) 1"
/protein_id="NP_036712.1"
/db_xref="GI:6981032"
/db_xref="GeneID:24451"
/db_xref="RATMAP:34040"
/db_xref="RGD:2806"
/translation="MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSR
EGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQ
EAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSS
GEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQ
ALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLS
FLLATVAVGIYAM"
ORIGIN
1 cgcctccaga gtttccgcct ccaaccagcg agtggagcct gccggagcag agccatctcg
61 agcggagccc ggagcctgaa gcgagcggag ccagcctgaa ctagcccagt cccgcgatgg
121 agcgcccaca gctcgacagc atgtcccagg atttgtccga ggccttgaag gaggccacca
181 aggaggtgca catccgtgca gagaattctg agttcatgag gaactttcag aagggtcagg
241 tgtccaggga aggctttaag ctggtgatgg cctccttgta ccatatctat acggccctgg
301 aagaggagat agagcgaaac aagcagaacc cagtctatgc cccactctac ttccctgagg
361 agctgcaccg aagggctgcc ctagagcagg acatggcctt ctggtatggg ccccactggc
421 aggaggccat cccttacaca ccagccacac agcactacgt aaagcgtctc cacgaggtgg
481 gaggtactca tcctgagctg ctggtggccc acgcatatac ccgctacctg ggtgacctct
541 cagggggtca ggtcctgaag aagattgcgc agaaggccat ggccttgcca agctctgggg
601 aaggcctggc ttttttcacc ttcccgagca tcgacaaccc caccaagttc aaacagctct
661 atcgtgctcg catgaacact ctggagatga cccccgaggt caagcacagg gtgacagaag
721 aggctaagac cgccttcctg ctcaacattg agctgtttga ggagctgcag gcactgctga
781 cagaggaaca caaagaccag agtccctcac agacagagtt tcttcgccag aggcctgcta
841 gcctggttca agatactacc tctgcagaga cgccccgagg aaaatcccag atcagcacta
901 gttcatccca gacaccgctc ctgcgatggg tcctcacact cagtttcctg ttggcgaccg
961 tggcagtggg aatttatgcc atgtaaatgc agtgttggcc cccagaggct gtgaactctg
1021 tctcatgtag ccttctctct gcaggggaga atcttgcctg gctctctttt cttgggcctc
1081 taagaaagct tttggggttc ctcgccccct tcctgtgtct tcctttgtct ctctggaatg
1141 gaaggagatg cctggcacat ttccctcacc aaaagcacag ccaggggcct gaacttggaa
1201 accagcagcc ccaaatcctg caacagagcc ccagaactgt ggtcggtaga ggcggctgtt
1261 ctgagcccag tgcccttggt agtcggcgtc catgttgact gaccatgact gctttccccc
1321 agcgtcatgg ccactttgat atcagtgtgc agagattttc tgtcttgtgt ttctgtcttg
1381 tttttgttat ttccccagtt ctaccagtgt aatggtattt tttgttgtat cgattgtttt
1441 tttattctaa ccaagtaggg ctgtcttttg aggggtgggt ggtatttaat aattgtaacc
1501 ttggtctcta acttctgtgt gaaataataa atggcattat ctaataaaaa aaaaaaaaaa
1561 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
//
扫码关注「实验菌」,入科研社群,领学习资源
更有优质直播、研选好物、福利活动等你来!