大家都在搜
Der P1,Der P1 Protein Recombinant,Der p 1, DERP1, Der-P1
SYNONYMSPeptidase 1, Major mite fecal allergen Der p 1, Allergen Der p I, Der p 1, DERP1, Der-P1.INTRODUCTIONDERP1 is a thiol protease, with a preference for substrates with a large hydrophobic side chain in the P2 position, or with basic residues. DERP1 is a C1 peptidase family member. DERP1 has extensive endopeptidase specificity. DERP1 is N-glycosylated. N-glycanase treatment does not completely remove carbohydrates, suggesting that the protein contains additional glycosylation sites. DERP1 causes an allergic reaction in humans. Common symptoms of mite allergy are bronchial asthma, allergic rhinitis and conjunctivitis. DERP1 binds to IgE in 80% of patients with house dust allergy.DESCRIPTIONThe E.Coli derived recombinant protein contains the Dermatophagoides pteronyssinus Dust Mite Der P1 protein (a.a. 20-320) and fused to a 6 His Tag at C-terminus, having a total Mw of 34.5kDa, pI 5.6. SOURCEEscherichia Coli.PURIFICATION METHODPurified by proprietary chromatographic technique. PURITYProtein is >95% pure as determined by 10% SDS-PAGE (coomassie staining).FORMULATION60mM NaCl and 50mM Tris-HCl pH 8.0. AMINO ACID SEQUENCEMSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFS GVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA REQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTI IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPY VVILHHHHHH. STABILITYDer-P1 although stable at 4°C for 1 week, should be stored below -18°C. SAFETY DATA SHEETUSAGEProspec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |