pLVX-TRE3G-Zsgreen1
Search name
pLVX-TRE3G-Zsgreen1,Plasmid pLVX-TRE3G-Zsgreen1,pLVX-TRE3G-Zsgreen1 vector
pLVX-TRE3G-Zsgreen1 Information
Promoter: TRE3GV, PGK
Replicon: pUC ori
Terminator: SV40 poly (A) signal
Plasmid classification: virus series, lentivirus cloning vector
Plasmid size: 9100bp
Prokaryotic resistance: Amp
Screening markers: Puro
Cloned strain: Stbl3
Culture conditions: 37 centigrade, aerobic LB
Expression host: mammalian cells
Inducement: tetracycline induction
5'sequencing primers: M13R:CAGGAAACAGCTATGACC
3'sequencing primers: primers designed according to sequence
Use:Lentiviral
pLVX-TRE3G-Zsgreen1 Description
The inducible promoter PTRE3G provides for very low basal expression and high maximal expression after induction. It consists of 7 repeats of a 19 bp tet operator sequence located upstream of a minimal CMV promoter. PTRE3GV is a version of PTRE3G that was modified at Clontech for higher performance in lentiviruses and retroviruses. In the presence of Dox, Tet-On 3G binds specifically to PTRE3GV and activates transcription of the downstream GOI. PTRE3GV lacks binding sites for endogenous mammalian transcription factors, so it is virtually silent in the absence of induction. pLVX-TRE3G-ZsGreen1 is an HIV-1-based, inducible lentiviral expression vector that allows the simultaneous expression of ZsGreen1 and your protein of interest in virtually any mammalian cell type, including primary cells.
pLVX-TRE3G-Zsgreen1 Sequence
LOCUS Exported 9100 bp ds-DNA circular SYN 27-AUG-2016
DEFINITION synthetic circular DNA
ACCESSION .
VERSION .
KEYWORDS Untitled 35
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9100)
AUTHORS .
TITLE Direct Submission
JOURNAL Exported Saturday, August 27, 2016 from SnapGene Viewer 3.1.4
FEATURES Location/Qualifiers
source 1..9100
/organism="synthetic DNA construct"
/mol_type="other DNA"
LTR 1..634
/note="3' LTR"
/note="3' long terminal repeat (LTR) from HIV-1"
misc_feature 681..806
/note="HIV-1 Psi"
/note="packaging signal of human immunodeficiency virus
type 1"
misc_feature 1303..1536
/note="RRE"
/note="The Rev response element (RRE) of HIV-1 allows for
Rev-dependent mRNA export from the nucleus to the
cytoplasm."
misc_feature 2028..2143
/note="cPPT/CTS"
/note="central polypurine tract and central termination
sequence of HIV-1 (lacking the first T)"
promoter 2206..2555
/note="TRE3GV promoter"
/note="3rd-generation Tet-responsive promoter that can be
activated by binding of Tet-On(R) 3G, optimized for
retroviral and lentiviral vectors"
protein_bind 2214..2232
/gene="tetO"
/bound_moiety="tetracycline repressor TetR"
/note="tet operator"
/note="bacterial operator O2 for the tetR and tetA genes"
protein_bind 2250..2268
/gene="tetO"
/bound_moiety="tetracycline repressor TetR"
/note="tet operator"
/note="bacterial operator O2 for the tetR and tetA genes"
protein_bind 2286..2304
/gene="tetO"
/bound_moiety="tetracycline repressor TetR"
/note="tet operator"
/note="bacterial operator O2 for the tetR and tetA genes"
protein_bind 2322..2340
/gene="tetO"
/bound_moiety="tetracycline repressor TetR"
/note="tet operator"
/note="bacterial operator O2 for the tetR and tetA genes"
protein_bind 2358..2376
/gene="tetO"
/bound_moiety="tetracycline repressor TetR"
/note="tet operator"
/note="bacterial operator O2 for the tetR and tetA genes"
protein_bind 2394..2412
/gene="tetO"
/bound_moiety="tetracycline repressor TetR"
/note="tet operator"
/note="bacterial operator O2 for the tetR and tetA genes"
protein_bind 2430..2448
/gene="tetO"
/bound_moiety="tetracycline repressor TetR"
/note="tet operator"
/note="bacterial operator O2 for the tetR and tetA genes"
misc_feature 3275..3849
/note="IRES"
/note="internal ribosome entry site (IRES) of the
encephalomyocarditis virus (EMCV)"
misc_feature 3299..3851
/note="IRES"
/note="internal ribosome entry site (IRES) of the
encephalomyocarditis virus (EMCV)"
promoter 3885..4384
/note="PGK promoter"
/note="mouse phosphoglycerate kinase 1 promoter"
CDS 4405..5004
/codon_start=1
/gene="pac from Streptomyces alboniger"
/product="puromycin N-acetyltransferase"
/note="PuroR"
/note="confers resistance to puromycin"
/translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"
misc_feature 5022..5610
/note="WPRE"
/note="woodchuck hepatitis virus posttranscriptional
regulatory element"
CDS complement(5493..5504)
/codon_start=1
/product="Factor Xa recognition and cleavage site"
/note="Factor Xa site"
/translation="IEGR"
LTR 5818..6451
/note="3' LTR"
/note="3' long terminal repeat (LTR) from HIV-1"
primer_bind complement(6580..6596)
/note="M13 rev"
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 6604..6620
/bound_moiety="lac repressor encoded by lacI"
/note="lac operator"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by ad <