Product description:
Human N-his-tag SDF-1 β produced in E. coli is non-glycosylated polypeptide chain containing 100 amino acids (28-100 a.a; predicted MW=11.67kDa). The SDF-1 β is fused to 28 amino acid His-tag at N-terminal. The recombinant protein was purified by Ni-NTA affinity column and followed by gel filtration chromatography. Purity was greater than 95% by Coomassie blue staining SDS-PAGE (Figure A). The protein was active in ELISA assay with an EC50 of about 160nM (Figure B) and the measure MW in LC-MS was 11548 Dalton, in agreeing with its theoretic molecular weight (Figure C).
GenBank accession number:
Amino acid sequence:
MGSSHHHHHHSSGLVPRGSHMENLYFQGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALNNRQVCIDPKLKWIQ
EYLEKALNKRFKM
Activity:
ELISA to measure SDF-1 binding activity (Figure 2). SDF-1 was immobilized on the plate and was detected by anti SDF-1 antibody (Santacruz sc-6193).
Formulation:
Lyophilized from a 0.22μm filtered solution at a concentration of 1mg/mlin PBS.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 1.0 mg/ml.
Shipping&Stablity:
The Product is shipped at ambient temperature. Upon reconstitution, the preparation is stable for up to 1 month at 2-8°C. For long term storage, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles
Figure A. The purity of recombinant protein his-tagSDF-1 β(AZ-001).15 % SDS-PAGE,1.2μg of SDF-1β.
Figure B. ELISA to measure the activity of His-SDF-1 β (AZ-001).
Figure C. The molecular weight of SDF-1 β was 11548 Dalton in LC-MS spectrum analysis, consistent with its calculated MW.
For ordering and further information on this or other AbZyme products, contact customer Services
Product |
Species |
Catalog# |
Amount |
His-SDF-1β |
human |
AZ-001-10 |
10μg |
His-SDF-1β |
human |
AZ-001-50 |
50μg |
His-SDF-1β |
human |
AZ-001-1mg |
1mg |
Products for Research Only.
Background:
SDF-1 (stromal cell-derived factor-1), also called CXCL12, is small cytokine belonging to the chemokine family. The two forms, SDF-1 alpha/CXCL12a and SDF-1 β/CXCL12b, are produced in cells by alternate splicing of the same gene. SDF-1 signal through its receptor CXCR4, and have been shown to chemoattract B and T cells, induce migration of CD34+ stem cells. Additionally, SDF-1 and its receptor CXCR4 are involved in human disease states (e.g. HIV/AIDS) and cancer metastasis