A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
规格:
100 ug
NCBI Gene Id: 6696
Swissprot Id: P10451
Osteopontin (OPN), also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1). The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. And the encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. Also, this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. - See more at: http://www.avivasysbio.com/sd/tds/html_datasheet.php?sku=OABB02131
Anti-Osteopontin antibody, OABB02131, Western blotting All lanes: Anti Osteopontin (OABB02131) at 0.5ug/ml Lane 1: Mouse Pancreas Tissue Lysate at 50ug Lane 2: JURKAT Whole Cell Lysate at 40ug Lane 3: HEPG2 Whole Cell Lysate at 40ug Predicted bind size: 66KD Observed bind size: 66KD