Rab1b Polyclonal Antibody

Form Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. Concentration 3.00 mg/ml Isotype IgG Clonality Polyclonal Conjugation Unconjugated Immunogen Purified recombinant peptide derived from within residues 110 aa to the C-terminus of Rab1b produced in E. coli. Antigen Sequence QEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPASGGCC Specificity Detects endogenous levels of Rab1b protein by Western blot in whole cell lysates and transfected cells with GFP-Rab1b cds. Storage Store at -20 C for long-term storage. Store at 2-8 C for up to one month. Special instructions The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.