mCherry Polyclonal Antibody

Catalog # AB0040 Category Antibodies Family Fluorescent Proteins Source Goat Application WB, IHC (F), IHC (P), IF, IEM Reactivity Transfected cells Description Goat polyclonal antibody to mCherry (Cherry fluorescent protein). Alternative names Cherry fluorescent protein, dsRed, red fluorescent protein, tdTomato antibody. Gene Identifier/Accession# N/A Form Polyclonal antibody supplied as a 200 or 500 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. Concentration 3.00 mg/ml Isotype IgG Clonality Polyclonal Conjugation Unconjugated Immunogen Purified recombinant peptide produced in E. coli. Antigen Sequence MTMITPSLHACRSTLEDPRVPVATMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK Specificity In 293HEK cells transfected with cds plasmid detects a band of 29 kDa by Western blot. This antibody recognizes very well tdTomato and does not recognize GFP (green fluorescent protein). Storage For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours. Special instructions Avoid freeze/thaw cycles