Rabbit Polyclonal Anti-CRY1 An

gene_symbol：CRY1
predicted_size：64 kDa
Uniprot ID：Q16526
description：Rabbit Polyclonal Anti-CRY1 Antibody
clonality：Polyclonal
product_type(primary antibody, secondy antibody ,tag antibody,Loding Control...)：Primary Antibodies
background：CRY1 is the blue light-dependent regulator of the circadian feedback loop. CRY1 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. CRY1 has no photolyase activity. CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. CRY1 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
immunogen：The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
recommended_dilution：WB, IHC
predicted_size：64 kDa
buffer：Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
host_species：Rabbit
applications：IHC, WB
reactivities：Human