Rabbit Polyclonal Anti-ACSL3 A

gene_symbol：ACSL3
predicted_size：80 kDa
Uniprot ID：O95573
description：Rabbit Polyclonal Anti-ACSL3 Antibody
clonality：Polyclonal
product_type(primary antibody, secondy antibody ,tag antibody,Loding Control...)：Primary Antibodies
background：The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
immunogen：The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
recommended_dilution：IHC, WB
predicted_size：80 kDa
buffer：Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
host_species：Rabbit
applications：IHC, WB
reactivities：Human