Rabbit Polyclonal Anti-RAET1G

gene_symbol：RAET1G
predicted_size：34 kDa
Uniprot ID：Q6H3X3
description：Rabbit Polyclonal Anti-RAET1G Antibody
clonality：Polyclonal
product_type(primary antibody, secondy antibody ,tag antibody,Loding Control...)：Primary Antibodies
background：Members of the RAET1 family, such as RAET1G, are major histocompatibility complex (MHC) class I-related genes located within a 180-kb cluster on chromosome 6q24.2-q25.3. RAET1 proteins contain MHC class I-like alpha-1 and alpha-2 domains. RAET1E and RAET1G differ from the other RAET1 proteins in that they have type I membrane-spanning sequences at their C termini rather than glycosylphosphatidylinositol anchor sequences.
immunogen：The immunogen for anti-RAET1G antibody is: synthetic peptide directed towards the middle region of Human RAET1G. Synthetic peptide located within the following region: HPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAGA
recommended_dilution：WB
predicted_size：34 kDa
buffer：Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
host_species：Rabbit
applications：WB
reactivities：Human