Rabbit Polyclonal Anti-PLXNB3

gene_symbol：PLXNB3
predicted_size：171 kDa
Uniprot ID：Q9ULL4
description：Rabbit Polyclonal Anti-PLXNB3 Antibody
clonality：Polyclonal
product_type(primary antibody, secondy antibody ,tag antibody,Loding Control...)：Primary Antibodies
background：The protein encoded by this gene is a member of the plexin family. It functions as a receptor for semaphorin 5A, and plays a role in axon guidance, invasive growth and cell migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
immunogen：The immunogen for anti-PLXNB3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLXNB3. Synthetic peptide located within the following region: DYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATVRQGLTQLSNLLNSKL
recommended_dilution：WB
predicted_size：171 kDa
buffer：Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
host_species：Rabbit
applications：WB
reactivities：Human