Rabbit Polyclonal Anti-LYCAT A

gene_symbol：LCLAT1
predicted_size：44 kDa
Uniprot ID：Q6UWP7
description：Rabbit Polyclonal Anti-LYCAT Antibody
clonality：Polyclonal
product_type(primary antibody, secondy antibody ,tag antibody,Loding Control...)：Primary Antibodies
background：LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.
immunogen：The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE
recommended_dilution：WB
predicted_size：44 kDa
buffer：Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
host_species：Rabbit
applications：WB
reactivities：Human