Rabbit Polyclonal Anti-LTN1 An

gene_symbol：LTN1
predicted_size：200 kDa
Uniprot ID：O94822
description：Rabbit Polyclonal Anti-LTN1 Antibody
clonality：Polyclonal
product_type(primary antibody, secondy antibody ,tag antibody,Loding Control...)：Primary Antibodies
background：ZNF294 may function as an E3 ubiquitin-protein ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
immunogen：The immunogen for anti-ZNF294 antibody: synthetic peptide directed towards the N terminal of human ZNF294. Synthetic peptide located within the following region: MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA
recommended_dilution：WB
predicted_size：200 kDa
buffer：Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
host_species：Rabbit
applications：null
reactivities：Human, Mouse