Rabbit Polyclonal anti-RBM10 a

gene_symbol：RBM10
predicted_size：104 kDa
Uniprot ID：P98175
description：Rabbit Polyclonal anti-RBM10 antibody
clonality：Polyclonal
product_type(primary antibody, secondy antibody ,tag antibody,Loding Control...)：Primary Antibodies
background：RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.
immunogen：The immunogen for anti-RBM10 antibody: synthetic peptide directed towards the N terminal of human RBM10. Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS
recommended_dilution：WB, IHC
predicted_size：104 kDa
buffer：Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
host_species：Rabbit
applications：IHC, WB
reactivities：Human, Mouse