dxo蛋白|有爪蟾蜍dxo蛋白|有爪蟾蜍dxo重组蛋白|Xe

Research Areas

Others

Uniprot ID

Q5HZT0

Gene Names

dxo

Alternative Name(s)

(DXO)(5'-3' exoribonuclease DXO)(Dom-3 homolog Z)(NAD-capped RNA hydrolase DXO)(DeNADding enzyme DXO)

Lead Time

3-7 business days

Organism

Xenopus laevis (African clawed frog)

Source

E.coli

Expression Region

1-401aa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Target Protein Sequence

MEGNKSMQREKIDRPMKRGPEQNSLSPPLAKCPFMSCSSLKTLHSLYQGSFPFYRLPSEVGHFSLDENRQYHQDNRKLRYYSPPVGIREKGSPGWNVMDGYESHYVRRNEDEKEGLLHILTWLEKNRGVLGAHVEGGSKRPIDRDFVTWRGHLTKILCTPYETQEGWLLAVTLFKGTFYISEQETEAAQKKRKERSLEQERLMYSGYKFESYICADSPDRQPSQSAVVNTNEGFCSVLLARLTSHSLLISGEVDCTDPSAKKSIPPTCYIELKSSAQIRNPHQQRSFNRYKLLKWWCQSFLLGIPIIVAGFRSPEGRIVSLETFKTSDIPHLVRGERNSWDPAVCMNFCNKFLSHIKSVVTRDDPRLVYLFAWEPGCDVTFTVHTDPEYTILPSWYVNSVN

MW

50.3 kDa

Purity

Greater than 85% as determined by SDS-PAGE.

Endotoxin

Not test.

Biological_Activity

/

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance

Decapping enzyme for NAD-capped RNAs: specifically hydrolyzes the nicotinamide adenine dinucleotide (NAD) cap from a subset of RNAs by removing the entire NAD moiety from the 5'-end of an NAD-capped RNA. The NAD-cap is present at the 5'-end of some RNAs and snoRNAs. In contrast to the canonical 5'-end N7 methylguanosine (m7G) cap, the NAD cap promotes mRNA decay. Also acts as a non-canonical decapping enzyme that removes the entire cap structure of m7G capped or incompletely capped RNAs and mediates their subsequent degradation. Specifically degrades pre-mRNAs with a defective 5'-end m7G cap and is part of a pre-mRNA capping quality control. Has decapping activity toward incomplete 5'-end m7G cap mRNAs such as unmethylated 5'-end-capped RNA (cap0), while it has no activity toward 2'-O-ribose methylated m7G cap (cap1). Also has 5'-3' exoribonuclease activities: The 5'-end monophosphate RNA is then degraded by the 5'-3' exoribonuclease activity, enabling this enzyme to decap and degrade incompletely capped mRNAs. Also possesses RNA 5'-pyrophosphohydrolase activity by hydrolyzing the 5'-end triphosphate to release pyrophosphates. Exhibits decapping activity towards FAD-capped RNAs. Exhibits decapping activity towards dpCoA-capped RNAs in vitro.

Function

/